Arginase 1 (ARG1) Rabbit mAb, Clone: [ARC1164], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4923S
Artikelname: Arginase 1 (ARG1) Rabbit mAb, Clone: [ARC1164], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4923S
Hersteller Artikelnummer: CNA4923S
Alternativnummer: MBL-CNA4923S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Arginase 1 (ARG1) (P05089).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1164]
Molekulargewicht: 35kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGD
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Arginase 1 (ARG1) (P05089).
Application Verdünnung: WB: WB,1:2000 - 1:6000|IF/ICC,1:50 - 1:200