CD62P/P-selectin Rabbit mAb, Clone: [ARC1229], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA4989S
Artikelname: CD62P/P-selectin Rabbit mAb, Clone: [ARC1229], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA4989S
Hersteller Artikelnummer: CNA4989S
Alternativnummer: MBL-CNA4989S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 731-830 of human CD62P/P-selectin (P16109).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1229]
Molekulargewicht: 91kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: SFHCLEGQLLNGSAQTACQENGHWSTTVPTCQAGPLTIQEALTYFGGAVASTIGLIMGGTLLALLRKRFRQKDDGKCPLNPHSHLGTYGVFTNAAFDPSP
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 731-830 of human CD62P/P-selectin (P16109).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000