UPF1/RENT1 Rabbit mAb, Clone: [ARC1268], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA5071S
Artikelname: UPF1/RENT1 Rabbit mAb, Clone: [ARC1268], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA5071S
Hersteller Artikelnummer: CNA5071S
Alternativnummer: MBL-CNA5071S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UPF1/RENT1 (Q92900).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1268]
Molekulargewicht: 124kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGPGGGGAGGPGGAGAGAAAGQLDAQVGPEGILQNGAVDDSVAKTSQLL
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human UPF1/RENT1 (Q92900).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000