p60 CAF1 Rabbit mAb, Clone: [ARC1269], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA5073S
Artikelname: p60 CAF1 Rabbit mAb, Clone: [ARC1269], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA5073S
Hersteller Artikelnummer: CNA5073S
Alternativnummer: MBL-CNA5073S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 459-559 of human p60 CAF1 (Q13112).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1269]
Molekulargewicht: 61kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PLPGPSEEKTLQPSSQNTKAHPSRRVTLNTLQAWSKTTPRRINLTPLKTDTPPSSVPTSVISTPSTEEIQSETPGDAQGSPPELKRPRLDENKGGTESLDP
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 459-559 of human p60 CAF1 (Q13112).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200