CBX4 Rabbit mAb, Clone: [ARC1201], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA5109S
Artikelname: CBX4 Rabbit mAb, Clone: [ARC1201], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA5109S
Hersteller Artikelnummer: CNA5109S
Alternativnummer: MBL-CNA5109S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 461-560 of human CBX4 (O00257).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1201]
Molekulargewicht: 61kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: EVILLDSDLDEPIDLRCVKTRSEAGEPPSSLQVKPETPASAAVAVAAAAAPTTTAEKPPAEAQDEPAESLSEFKPFFGNIIITDVTANCLTVTFKEYVTV
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 461-560 of human CBX4 (O00257).
Application Verdünnung: WB: WB,1:500 - 1:1000|IP,1:500 - 1:1000