IGF2BP2/IMP2 Rabbit mAb, Clone: [ARC1203], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA5189S
Artikelname: IGF2BP2/IMP2 Rabbit mAb, Clone: [ARC1203], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA5189S
Hersteller Artikelnummer: CNA5189S
Alternativnummer: MBL-CNA5189S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 500-595 of human IGF2BP2/IMP2 (NP_001007226.1).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1203]
Molekulargewicht: 66kDa/62kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: NFFNPKEEVKLEAHIRVPSSTAGRVIGKGGKTVNELQNLTSAEVIVPRDQTPDENEEVIVRIIGHFFASQTAQRKIREIVQQVKQQEQKYPQGVAS
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 500-595 of human IGF2BP2/IMP2 (NP_001007226.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000