DHX36 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5191S
Artikelname: DHX36 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5191S
Hersteller Artikelnummer: CNA5191S
Alternativnummer: MBL-CNA5191S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human DHX36 (NP_065916.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 115kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MSYDYHQNWGRDGGPRSSGGGYGGGPAGGHGGNRGSGGGGGGGGGGRGGRGRHPGHLKGREIGMWYAKKQGQKNKEAERQERAVVHMDERREEQIVQLLNSVQAKNDKESEAQISWFAPEDHGYGTEVSTKNTPCSENKLDIQEKKLINQEKKMFRIRNRSYIDRDSEYLLQENEPDGTLDQKLLEDLQKKKNDLRYIEMQHFREKLPSYGMQKELVNLIDNHQVTVISGETGCGKTTQVTQFILDNYIERGKG
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human DHX36 (NP_065916.2).
Application Verdünnung: WB: WB,1:200 - 1:2000|IP,1:50 - 1:100