P23/PTGES3 Rabbit mAb, Clone: [ARC1986], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA5194S
Artikelname: P23/PTGES3 Rabbit mAb, Clone: [ARC1986], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA5194S
Hersteller Artikelnummer: CNA5194S
Alternativnummer: MBL-CNA5194S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human P23/PTGES3 (NP_006592.3).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1986]
Molekulargewicht: 19kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSKLTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTDRSILCCLRKGESGQSWPRLTKERAKLNWLS
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human P23/PTGES3 (NP_006592.3).
Application Verdünnung: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200