DP1/TFDP1 Rabbit mAb, Clone: [ARC1202], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA5214S
Artikelname: DP1/TFDP1 Rabbit mAb, Clone: [ARC1202], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA5214S
Hersteller Artikelnummer: CNA5214S
Alternativnummer: MBL-CNA5214S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 311-410 of human DP1/TFDP1 (Q14186).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1202]
Molekulargewicht: 45kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: SGSCSAEDLKMARSLVPKALEPYVTEMAQGTVGGVFITTAGSTSNGTRFSASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDEDD
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 311-410 of human DP1/TFDP1 (Q14186).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200