DLDH/DLD Rabbit mAb, Clone: [ARC1224], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA5220S
Artikelname: DLDH/DLD Rabbit mAb, Clone: [ARC1224], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA5220S
Hersteller Artikelnummer: CNA5220S
Alternativnummer: MBL-CNA5220S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 401-500 of human DLDH/DLD (P09622).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1224]
Molekulargewicht: 54kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: WVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLA
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 401-500 of human DLDH/DLD (P09622).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200