ESE1/ELF3 Rabbit mAb, Clone: [ARC1191], Unconjugated, Monoclonal
Artikelnummer:
MBL-CNA5236S
Artikelname: |
ESE1/ELF3 Rabbit mAb, Clone: [ARC1191], Unconjugated, Monoclonal |
Artikelnummer: |
MBL-CNA5236S |
Hersteller Artikelnummer: |
CNA5236S |
Alternativnummer: |
MBL-CNA5236S |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
ChIP, WB |
Spezies Reaktivität: |
Human, Mouse, Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-371 of human ESE1/ELF3 (P78545). |
Konjugation: |
Unconjugated |
Klonalität: |
Monoclonal |
Klon-Bezeichnung: |
[ARC1191] |
Molekulargewicht: |
41kDa |
Puffer: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol |
Sequenz: |
MAATCEISNIFSNYFSAMYSSEDSTLASVPPAATFGADDLVLTLSNPQMSLEGTEKASWLGEQPQFWSKTQVLDWISYQVEKNKYDASAIDFSRCDMDGATLCNCALEELRLVFGPLGDQLHAQLRDLTSSSSDELSWIIELLEKDGMAFQEALDPGPFDQGSPFAQELLDDGQQASPYHPGSCGAGAPSPGSSDVSTAGTGASRSSHSSDSGGSDVDLDPTDGKLFPSDGFRDCKKGDPKHGKRKRGRPRKLS |
Target-Kategorie: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-371 of human ESE1/ELF3 (P78545). |
Application Verdünnung: |
WB: WB,1:500 - 1:2000|ChIP,1:50 - 1:200|CUT&Tag, 105 cells /1 µg |