GM130 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5344P
Artikelname: GM130 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5344P
Hersteller Artikelnummer: CNA5344P
Alternativnummer: MBL-CNA5344P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-300 of human GM130 (NP_004477.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 113kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: SKLAAAKKKLREYQQRNSPGVPTGAKKKKKIKNGSNPETTTSGGCHSPEDTPKDNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKTFSSTESLRQLSQQLNGLVCESATCVNGEGPASSANLKDLESRYQQLAVALDSSYVTNKQLNITIEKLKQQNQEITDQLEEEKKECHQKQGALREQLQVHIQTIGILVSEKAELQTALAHTQHAARQKEGESEDLASRLQYSRRRVGELERALS
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 20-300 of human GM130 (NP_004477.3).
Application Verdünnung: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:100 - 1:500