[KO Validated] HADHA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5346S
Artikelname: [KO Validated] HADHA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5346S
Hersteller Artikelnummer: CNA5346S
Alternativnummer: MBL-CNA5346S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 484-763 of human HADHA (NP_000173.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 83kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: IAAVSKRPEKVIGMHYFSPVDKMQLLEIITTEKTSKDTSASAVAVGLKQGKVIIVVKDGPGFYTTRCLAPMMSEVIRILQEGVDPKKLDSLTTSFGFPVGAATLVDEVGVDVAKHVAEDLGKVFGERFGGGNPELLTQMVSKGFLGRKSGKGFYIYQEGVKRKDLNSDMDSILASLKLPPKSEVSSDEDIQFRLVTRFVNEAVMCLQEGILATPAEGDIGAVFGLGFPPCLGGPFRFVDLYGAQKIVDRLKKYE
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 484-763 of human HADHA (NP_000173.2).
Application Verdünnung: WB: WB,1:2000 - 1:6000|IF/ICC,1:50 - 1:200|IP,1:50 - 1:100