Syntenin Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5360S
Artikelname: Syntenin Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5360S
Hersteller Artikelnummer: CNA5360S
Alternativnummer: MBL-CNA5360S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human Syntenin (NP_001007068.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 32kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQI
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-260 of human Syntenin (NP_001007068.1).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200