CART Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5395T
Artikelname: CART Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5395T
Hersteller Artikelnummer: CNA5395T
Alternativnummer: MBL-CNA5395T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-116 of human CART (NP_004282.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 13kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: EKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 50-116 of human CART (NP_004282.1).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200