MAGE-1/MAGE1A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5470S
Artikelname: MAGE-1/MAGE1A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5470S
Hersteller Artikelnummer: CNA5470S
Alternativnummer: MBL-CNA5470S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-309 of human MAGE-1/MAGE1A (NP_004979.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 34kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MSLEQRSLHCKPEEALEAQQEALGLVCVQAATSSSSPLVLGTLEEVPTAGSTDPPQSPQGASAFPTTINFTRQRQPSEGSSSREEEGPSTSCILESLFRAVITKKVADLVGFLLLKYRAREPVTKAEMLESVIKNYKHCFPEIFGKASESLQLVFGIDVKEADPTGHSYVLVTCLGLSYDGLLGDNQIMPKTGFLIIVLVMIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLEYRQV
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-309 of human MAGE-1/MAGE1A (NP_004979.3).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100