PLA2G1B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5478T
Artikelname: PLA2G1B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5478T
Hersteller Artikelnummer: CNA5478T
Alternativnummer: MBL-CNA5478T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 23-148 of human PLA2G1B (NP_000919.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 16kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: AVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 23-148 of human PLA2G1B (NP_000919.1).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200