[KO Validated] DNAJB1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5504S
Artikelname: [KO Validated] DNAJB1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5504S
Hersteller Artikelnummer: CNA5504S
Alternativnummer: MBL-CNA5504S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-340 of human DNAJB1 (NP_006136.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 38kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDV
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-340 of human DNAJB1 (NP_006136.1).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200