JAK1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5534T
Artikelname: JAK1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5534T
Hersteller Artikelnummer: CNA5534T
Alternativnummer: MBL-CNA5534T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 810-910 of human JAK1 (NP_002218.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 133kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: CRPVTPSCKELADLMTRCMNYDPNQRPFFRAIMRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNTGEQVAVKSL
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 810-910 of human JAK1 (NP_002218.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200