RING1B/RNF2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5563P
Artikelname: RING1B/RNF2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5563P
Hersteller Artikelnummer: CNA5563P
Alternativnummer: MBL-CNA5563P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-336 of human RING1B/RING1B/RNF2 (NP_009143.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 38kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: MSQAVQTNGTQPLSKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELVFRPHPTLMEKDDSAQTRYIKTSGNA
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-336 of human RING1B/RING1B/RNF2 (NP_009143.1).
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:50 - 1:200|ChIP,1:50 - 1:200