SLC8A1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5583T
Artikelname: SLC8A1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5583T
Hersteller Artikelnummer: CNA5583T
Alternativnummer: MBL-CNA5583T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human SLC8A1 (NP_066920.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 109kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: DEIVKTISVKVIDDEEYEKNKTFFLEIGEPRLVEMSEKKALLLNELGGFTITGKYLFGQPVFRKVHAREHPILSTVITIADEYDDKQPLTSKEEEERRIAE
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 600-700 of human SLC8A1 (NP_066920.1).
Application Verdünnung: WB: WB,1:2000 - 1:6000|IHC-P,1:50 - 1:200