ICAM-1/CD54 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5597P
Artikelname: ICAM-1/CD54 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5597P
Hersteller Artikelnummer: CNA5597P
Alternativnummer: MBL-CNA5597P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 120-320 of human ICAM-1/CD54 (NP_000192.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 58kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: PLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKP
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 120-320 of human ICAM-1/CD54 (NP_000192.2).
Application Verdünnung: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200