ABCG2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5661P
Artikelname: ABCG2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5661P
Hersteller Artikelnummer: CNA5661P
Alternativnummer: MBL-CNA5661P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABCG2 (NP_004818.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 72kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: SGLSGDVLINGAPRPANFKCNSGYVVQDDVVMGTLTVRENLQFSAALRLATTMTNHEKNERINRVIQELGLDKVADSKVGTQFIRGVSGGERKRTSIGMEL
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human ABCG2 (NP_004818.2).
Application Verdünnung: WB: WB,1:1000 - 1:5000|IF/ICC,1:50 - 1:200