[KO Validated] SIRT3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5718P
Artikelname: [KO Validated] SIRT3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5718P
Hersteller Artikelnummer: CNA5718P
Alternativnummer: MBL-CNA5718P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human SIRT3 (NP_036371.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 44kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: QRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human SIRT3 (NP_036371.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:20 - 1:50|IF/ICC,1:50 - 1:200