[KO Validated] CDK5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5730T
Artikelname: [KO Validated] CDK5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5730T
Hersteller Artikelnummer: CNA5730T
Alternativnummer: MBL-CNA5730T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 170-289 of human CDK5 (NP_004926.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 33kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: PDVLFGAKLYSTSIDMWSAGCIFAELANAGRPLFPGNDVDDQLKRIFRLLGTPTEEQWPSMTKLPDYKPYPMYPATTSLVNVVPKLNATGRDLLQNLLKCNPVQRISAEEALQHPYFSDF
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 170-289 of human CDK5 (NP_004926.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:10 - 1:100|IP,1:500 - 1:1000