DAP Kinase 1 (DAPK1) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5741T
Artikelname: DAP Kinase 1 (DAPK1) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5741T
Hersteller Artikelnummer: CNA5741T
Alternativnummer: MBL-CNA5741T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1230-1430 of human DAP Kinase 1 (DAPK1) (NP_004929.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 160kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: LLTVKHYLSPQQLREHHEPVMIYQPRDFFRAQTLKETSLTNTMGGYKESFSSIMCFGCHDVYSQASLGMDIHASDLNLLTRRKLSRLLDPPDPLGKDWCLLAMNLGLPDLVAKYNTSNGAPKDFLPSPLHALLREWTTYPESTVGTLMSKLRELGRRDAADFLLKASSVFKINLDGNGQEAYASSCNSGTSYNSISSVVSR
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1230-1430 of human DAP Kinase 1 (DAPK1) (NP_004929.2).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:100