GRO alpha Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5802P
Artikelname: GRO alpha Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5802P
Hersteller Artikelnummer: CNA5802P
Alternativnummer: MBL-CNA5802P
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 28-107 of human GRO alpha (NP_001502.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 11kDa
Puffer: PBS with 0.05% proclin300,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.05% proclin300,50% glycerol
Sequenz: AGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 28-107 of human GRO alpha (NP_001502.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200