BTAF1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5811S
Artikelname: BTAF1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5811S
Hersteller Artikelnummer: CNA5811S
Alternativnummer: MBL-CNA5811S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, IP, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1600-1849 of human BTAF1 (NP_003963.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 207kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LAVQNSSLHDIQHAPKLSALKQLLLDCGLGNGSTSESGTESVVAQHRILIFCQLKSMLDIVEHDLLKPHLPSVTYLRLDGSIPPGQRHSIVSRFNNDPSIDVLLLTTHVGGLGLNLTGADTVVFVEHDWNPMRDLQAMDRAHRIGQKRVVNVYRLITRGTLEEKIMGLQKFKMNIANTVISQENSSLQSMGTDQLLDLFTLDKDGKAEKADTSTSGKASMKSILENLSDLWDQEQYDSEYSLENFMHSLK
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1600-1849 of human BTAF1 (NP_003963.1).
Application Verdünnung: WB: WB,1:500 - 1:2000|IP,1:20 - 1:50|ChIP,1:20 - 1:100