MBL2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5825S
Artikelname: MBL2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5825S
Hersteller Artikelnummer: CNA5825S
Alternativnummer: MBL-CNA5825S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 21-248 of human MBL2 (NP_000233.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 26kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 21-248 of human MBL2 (NP_000233.1).
Application Verdünnung: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200