NCL Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5904T
Artikelname: NCL Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5904T
Hersteller Artikelnummer: CNA5904T
Alternativnummer: MBL-CNA5904T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 300-466 of human NCL (NP_005372.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 77kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: GTEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDLEKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIRLVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGE
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 300-466 of human NCL (NP_005372.2).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200