ATM Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5908S
Artikelname: ATM Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5908S
Hersteller Artikelnummer: CNA5908S
Alternativnummer: MBL-CNA5908S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1900-2000 of human ATM (NP_000042.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 351kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: CLDKKSQRTMLAVVDYMRRQKRPSSGTIFNDAFWLDLNYLEVAKVAQSCAAHFTALLYAEIYADKKSMDDQEKRSLAFEEGSQSTTISSLSEKSKEETGIS
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1900-2000 of human ATM (NP_000042.3).
Application Verdünnung: WB: WB,1:500 - 1:1000