TWEAKR/Fn14/CD266 Rabbit mAb, Clone: [ARC2119], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA5955S
Artikelname: TWEAKR/Fn14/CD266 Rabbit mAb, Clone: [ARC2119], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA5955S
Hersteller Artikelnummer: CNA5955S
Alternativnummer: MBL-CNA5955S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-129 of human TWEAKR/Fn14/CD266 (Q9NP84).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2119]
Molekulargewicht: 14kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: MDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 50-129 of human TWEAKR/Fn14/CD266 (Q9NP84).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200