TRMT2A/HTF9C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA5975S
Artikelname: TRMT2A/HTF9C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA5975S
Hersteller Artikelnummer: CNA5975S
Alternativnummer: MBL-CNA5975S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human TRMT2A/HTF9C (NP_073564.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 69kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LASQHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVKGIPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGPHSPPAQPTPGPPDNTLQETGTFPSS
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 500 to the C-terminus of human TRMT2A/HTF9C (NP_073564.3).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200