Syntaxin 4 Rabbit mAb, Clone: [ARC2113], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA5996S
Artikelname: Syntaxin 4 Rabbit mAb, Clone: [ARC2113], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA5996S
Hersteller Artikelnummer: CNA5996S
Alternativnummer: MBL-CNA5996S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Syntaxin 4 (NP_004595.2)).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC2113]
Molekulargewicht: 34kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: QTIVKLGNKVQELEKQQVTILATPLPEESMKQELQNLRDEIKQLGREIRLQLKAIEPQKEEADENYNSVNTRMRKTQHGVLSQQFVELINKCNSMQSEYRE
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Syntaxin 4 (NP_004595.2)).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200