Argonaute-2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6023S
Artikelname: Argonaute-2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6023S
Hersteller Artikelnummer: CNA6023S
Alternativnummer: MBL-CNA6023S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Argonaute-2 (NP_036286.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 97kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MYSGAGPALAPPAPPPPIQGYAFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYELDIKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNL
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Argonaute-2 (NP_036286.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200