PABPN1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6041S
Artikelname: PABPN1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6041S
Hersteller Artikelnummer: CNA6041S
Alternativnummer: MBL-CNA6041S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PABPN1 (NP_004634.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 33kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAPPGAPGPGPGSGAPGSQEEEE
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PABPN1 (NP_004634.1).
Application Verdünnung: WB: WB,1:500 - 1:1000