PRPF8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6053S
Artikelname: PRPF8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6053S
Hersteller Artikelnummer: CNA6053S
Alternativnummer: MBL-CNA6053S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRPF8 (NP_006436.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 274kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRKFRHDKRVYLGALKYMPHAVL
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PRPF8 (NP_006436.3).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:100|IP,1:50 - 1:100