SRRM1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6066T
Artikelname: SRRM1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6066T
Hersteller Artikelnummer: CNA6066T
Alternativnummer: MBL-CNA6066T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human SRRM1 (NP_005830.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 102kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MDAGFFRGTSAEQDNRFSNKQKKLLKQLKFAECLEKKVDMSKVNLEVIKPWITKRVTEILGFEDDVVIEFIFNQLEVKNPDSKMMQINLTGFLNGKNAREFMGELWPLLLSAQENIAGIPSAFLELKKEEIKQRQIEQEKLASMKKQDEDKDKRDKEEKE
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human SRRM1 (NP_005830.2).
Application Verdünnung: WB: WB,1:500 - 1:1000|IHC-P,1:100 - 1:500