TIAL1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6075T
Artikelname: TIAL1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6075T
Hersteller Artikelnummer: CNA6075T
Alternativnummer: MBL-CNA6075T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 266-375 of human TIAL1 (NP_003243.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 42kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: EGHVVKCYWGKESPDMTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPPQGQAPPPVIPPPNQAGYGMASYQTQ
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 266-375 of human TIAL1 (NP_003243.1).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:200