RICTOR Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
MBL-CNA6131P
Artikelname: |
RICTOR Rabbit pAb, Unconjugated, Polyclonal |
Artikelnummer: |
MBL-CNA6131P |
Hersteller Artikelnummer: |
CNA6131P |
Alternativnummer: |
MBL-CNA6131P |
Hersteller: |
MBL |
Wirt: |
Rabbit |
Kategorie: |
Antikörper |
Applikation: |
WB |
Spezies Reaktivität: |
Rat |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1290-1500 of human RICTOR (NP_689969.2). |
Konjugation: |
Unconjugated |
Klonalität: |
Polyclonal |
Molekulargewicht: |
192kDa |
Puffer: |
PBS with 0.05% proclin300,50% glycerol |
Quelle: |
Rabbit |
Reinheit: |
Affinity purification |
Formulierung: |
PBS with 0.05% proclin300,50% glycerol |
Sequenz: |
PGSSHTLPRRAQSLKAPSIATIKSLADCNFSYTSSRDAFGYATLKRLQQQRMHPSLSHSEALASPAKDVLFTDTITMKANSFESRLTPSRFMKALSYASLDKEDLLSPINQNTLQRSSSVRSMVSSATYGGSDDYIGLALPVDINDIFQVKDIPYFQTKNIPPHDDRGARAFAHDAGGLPSGTGGLVKNSFHLLRQQMSLTEIMNSIHSDA |
Target-Kategorie: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1290-1500 of human RICTOR (NP_689969.2). |
Application Verdünnung: |
WB: WB,1:100 - 1:500 |