ALKBH1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6240S
Artikelname: ALKBH1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6240S
Hersteller Artikelnummer: CNA6240S
Alternativnummer: MBL-CNA6240S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 110-389 of human ALKBH1 (NP_006011.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 44kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: YQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKR
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 110-389 of human ALKBH1 (NP_006011.2).
Application Verdünnung: WB: WB,1:500 - 1:2000|IP,1:50 - 1:200