Placental alkaline phosphatase (PLAP) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6353S
Artikelname: Placental alkaline phosphatase (PLAP) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6353S
Hersteller Artikelnummer: CNA6353S
Alternativnummer: MBL-CNA6353S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC-P, IP, WB
Spezies Reaktivität: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 260-460 of human Placental alkaline phosphatase (PLAP) (NP_001623.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 58kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: LAKRQGARYVWNRTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLMEMTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVTESESGSPEYRQQSAVPLDEETHAGEDVA
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 260-460 of human Placental alkaline phosphatase (PLAP) (NP_001623.3).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,1:50 - 1:100