DHRS2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6446T
Artikelname: DHRS2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6446T
Hersteller Artikelnummer: CNA6446T
Alternativnummer: MBL-CNA6446T
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human DHRS2 (NP_878912.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 30kDa
Puffer: PBS with 0.01% thimerosal,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.01% thimerosal,50% glycerol
Sequenz: MLSAVARGYQGWFHPCARLSVRMSSTGIDRKGVLANRVAVVTGSTSGIGFAIARRLARDGAHVVISSRKQQNVDRAMAKLQGEGLSVAGIVCHVGKAEDREQLVAKALEHCGGVDFLVCSAGVNPLVGSTLGTSEQIWDKILSVNVKSPALLLSQLLPYMENRRGAVILVSSIAAYNPVVALGVYNVSKTALLGLTRTLALELAPKDIRVNCVVPGIIKTDFSKVVRIGFMGMSLSGRTSRNIISCRGLGSQRT
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human DHRS2 (NP_878912.1).
Application Verdünnung: WB: WB,1:500 - 1:1000|IF/ICC,1:10 - 1:100