[KO Validated] POLE3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6469S
Artikelname: [KO Validated] POLE3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6469S
Hersteller Artikelnummer: CNA6469S
Alternativnummer: MBL-CNA6469S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human POLE3 (NP_059139.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 17kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGKRKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQDKSRDEDNDEDEERLEEEEQNEEEEVDN
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-147 of human POLE3 (NP_059139.3).
Application Verdünnung: WB: WB,1:500 - 1:2000