DDX1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6575S
Artikelname: DDX1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6575S
Hersteller Artikelnummer: CNA6575S
Alternativnummer: MBL-CNA6575S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 441-740 of human DDX1 (NP_004930.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 82kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: VHHVVVPVNPKTDRLWERLGKSHIRTDDVHAKDNTRPGANSPEMWSEAIKILKGEYAVRAIKEHKMDQAIIFCRTKIDCDNLEQYFIQQGGGPDKKGHQFSCVCLHGDRKPHERKQNLERFKKGDVRFLICTDVAARGIDIHGVPYVINVTLPDEKQNYVHRIGRVGRAERMGLAISLVATEKEKVWYHVCSSRGKGCYNTRLKEDGGCTIWYNEMQLLSEIEEHLNCTISQVEPDIKVPVDEFDGKVTYGQKR
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 441-740 of human DDX1 (NP_004930.1).
Application Verdünnung: WB: WB,1:1000 - 1:5000|IP,1:1000 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200