FRZB Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6592S
Artikelname: FRZB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6592S
Hersteller Artikelnummer: CNA6592S
Alternativnummer: MBL-CNA6592S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 166-325 of human FRZB (NP_001454.2).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 36kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: SNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKCHDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKDRLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 166-325 of human FRZB (NP_001454.2).
Application Verdünnung: WB: WB,1:2000 - 1:7000