INPP5J Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6631S
Artikelname: INPP5J Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6631S
Hersteller Artikelnummer: CNA6631S
Alternativnummer: MBL-CNA6631S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 60-360 of human INPP5J (NP_001002837.1).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 107kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: VTWNVGTAMPPDDVTSLLHLGGGDDSDGADMIAIGLQEVNSMLNKRLKDALFTDQWSELFMDALGPFNFVLVSSVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNKGGVSVRLAAFGHMLCFLNCHLPAHMDKAEQRKDNFQTILSLQQFQGPGAQGILDHDLVFWFGDLNFRIESYDLHFVKFAIDSDQLHQLWEKDQLNMAKNTWPILKGFQEGPLNFAPTFKFDVGTNKYDTSAKKRKPAWTDR
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 60-360 of human INPP5J (NP_001002837.1).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:10 - 1:100