KIF3A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: MBL-CNA6639S
Artikelname: KIF3A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: MBL-CNA6639S
Hersteller Artikelnummer: CNA6639S
Alternativnummer: MBL-CNA6639S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ICC, IF, IHC-P, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 430-699 of human KIF3A (NP_008985.3).
Konjugation: Unconjugated
Klonalität: Polyclonal
Molekulargewicht: 80kDa
Puffer: PBS with 0.02% sodium azide,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,50% glycerol
Sequenz: RKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKAEEQEKLLEESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEMADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPRDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMRKQTPVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGR
Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 430-699 of human KIF3A (NP_008985.3).
Application Verdünnung: WB: WB,1:500 - 1:2000|IHC-P,1:100 - 1:500|IF/ICC,1:50 - 1:200|IP,1:50 - 1:200