KDM4B/JMJD2B Rabbit mAb, Clone: [ARC1416], Unconjugated, Monoclonal

Artikelnummer: MBL-CNA6670S
Artikelname: KDM4B/JMJD2B Rabbit mAb, Clone: [ARC1416], Unconjugated, Monoclonal
Artikelnummer: MBL-CNA6670S
Hersteller Artikelnummer: CNA6670S
Alternativnummer: MBL-CNA6670S
Hersteller: MBL
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ChIP, ICC, IF, IP, WB
Spezies Reaktivität: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KDM4B/JMJD2B (O94953).
Konjugation: Unconjugated
Klonalität: Monoclonal
Klon-Bezeichnung: [ARC1416]
Molekulargewicht: 122kDa
Puffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Quelle: Rabbit
Reinheit: Affinity purification
Formulierung: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequenz: PPKEWKPRQTYDDIDDVVIPAPIQQVVTGQSGLFTQYNIQKKAMTVGEYRRLANSEKYCTPRHQDFDDLERKYWKNLTFVSPIYGADISGSLYDDDVAQWN
Target-Kategorie: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KDM4B/JMJD2B (O94953).
Application Verdünnung: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000|ChIP,1:500 - 1:1000