Phospholipid Scramblase 1 (PLSCR1) Rabbit pAb, Unconjugated, Polyclonal

Produktübersicht

• Artikelname: Phospholipid Scramblase 1 (PLSCR1) Rabbit pAb, Unconjugated, Polyclonal
• Artikelnummer: MBL-CNA6691S
• Hersteller Artikelnummer: CNA6691S
• Alternativnummer: MBL-CNA6691S
• Hersteller: MBL
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: WB
• Spezies Reaktivität: Human
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-318 of human Phospholipid Scramblase 1 (Phospholipid Scramblase 1 (PLSCR1)) (NP_066928.1).
• Konjugation: Unconjugated

Produkteigenschaften

• Klonalität: Polyclonal
• Molekulargewicht: 35kDa
• Puffer: PBS with 0.02% sodium azide,50% glycerol
• Quelle: Rabbit
• Reinheit: Affinity purification
• Formulierung: PBS with 0.02% sodium azide,50% glycerol
• Sequenz: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDEQC
• Target-Kategorie: Recombinant fusion protein containing a sequence corresponding to amino acids 1-318 of human Phospholipid Scramblase 1 (Phospholipid Scramblase 1 (PLSCR1)) (NP_066928.1).

Anwendungsbeschreibung

• Application Verdünnung: WB: WB,1:500 - 1:2000